top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Greengage Jam 340g

Greengage Jam 340g

£3.79Price

A classic English fruit, producing a sweet and juicy jam. 2011 Great Taste Award Winner.

Prepared with 46g of Fruit per 100g. Total Sugar Content 61g per 100g.

Ingredients: Sugar, Greengages, Concentrated Lemon Juice, Gelling Agent: Citrus Pectin.

May contain fruit stones.

NUTRITIONAL INFOMATION TYPICAL VALUES per 100g. Energy 1054 kJ/248 kcal, Fat 0g of which saturates 0g, Carbohydrate 61g of which sugars 61g, Protein 0g, Salt 0g

bottom of page