top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Passionfruit Curd 310g

Passionfruit Curd 310g

£4.10Price

A wonderful ingredient carrying a great deal of punchy flavour. Ideal to use in puddings or ice cream. 2012 Great Taste Award Winner.
Ingredients: Sugar, Passionfruit Juice (22%), Pasteurised Free Range EGG, Pasteurised Free Range EGG Yolk, Butter (MILK, Salt), Acidity Regulator: Citric Acid, Gelling Agent: Citrus Pectin.
Allergy Advice: For allergens, see ingredients in CAPS.
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1559 kJ/371 kcal, Fat 14g of which saturates 6.9g, Carbohydrate 57g of which sugars 57g, Protein 3.9g, Salt 0.23g.

Related Products

bottom of page