courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Passionfruit Curd 310g

Passionfruit Curd 310g

£3.09Price

A wonderful ingredient carrying a great deal of punchy flavour. Ideal to use in puddings or ice cream. 2012 Great Taste Award Winner.
Ingredients: Sugar, Passionfruit Juice (22%), Pasteurised Free Range EGG, Pasteurised Free Range EGG Yolk, Butter (MILK, Salt), Acidity Regulator: Citric Acid, Gelling Agent: Citrus Pectin.
Allergy Advice: For allergens, see ingredients in CAPS.
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1559 kJ/371 kcal, Fat 14g of which saturates 6.9g, Carbohydrate 57g of which sugars 57g, Protein 3.9g, Salt 0.23g.
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest