top of page
  • Pinterest
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Air Dried Pork Loin 50g

Air Dried Pork Loin 50g

£6.50Price

Air Dried Pork Loin 50g, A delicately flavoured air dried sliced British cured pork loin.

 

  • Ready to eat 50g sliced pack
  • Oak smoked in our converted grain silo
  • High in protein and low in carbs
  • Absolutely zero sugars and no added nasties
  • 100% Free range British pork loin
  • Marinated in Greek Cypriot red wine

Related Products