top of page
  • Pinterest
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Gluten Free Dark Choc & Coconut Biscuit Break Chunky 160g

Gluten Free Dark Choc & Coconut Biscuit Break Chunky 160g

£3.09Price

Gluten Free Dark Choc & Coconut Biscuit Break Chunky 160g, At Nairn's, we're passionate about baking. We've recently created a chunky variety of our popular biscuit breaks range for you to enjoy — with a light, crumbly texture and deliciously full of flavour, they are perfect for those looking for something a little bit chunkier to have with a cuppa. Tropical coconut and rich dark chocolate are a deliciously indulgent combination but with all the benefits of wholegrain oats, you needn't feel quite as guilty when you reach for a treat.

Our tasty Chunky Biscuit Breaks come in handy pouch packs making them easy to pop in your bag for a mid-morning or afternoon snack on the go. Or simply enjoy them as the perfect accompaniment to your favourite hot or cold drink at any time of day.

 

Ingredients

Gluten Free Wholegrain Oats (57%), Sustainable Palm Fruit Oil, Dark Chocolate Chips (10%) (Sugar, Cocoa Mass, Cocoa Butter, Emulsifier: Lecithins (Soya), Natural Vanilla Flavouring), Brown Sugar, Desiccated Coconut (5%), Tapioca Starch, Partially Inverted Refiners Syrup; Lyles Golden Syrup, Raising Agents (Sodium Carbonates, Disodium Diphosphate), Natural Flavouring, Sea Salt, Rice Flour.

Allergy Advice

For allergens see ingredients in bold. May contain traces of Milk. Both our recipe and factory are nut free. We cannot guarantee that our ingredients are nut free.

Not suitable if you react to Avenin — a protein in oats.

Quantity
Get to know
The Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Recipes

Contact

Visit Our Shop

8 West Street,

Wilton Town Centre,

Wiltshire

SP2 0DF

©2025 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

bottom of page