top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Air Dried Beef 50g

Air Dried Beef 50g

£6.50Price

Air Dried Beef 50g, 1* Great Taste Awards winner 2022!
A ‘pastourma’ spiced flavoursome air dried beef that will wow most palates.

  • Ready to eat sliced 50g pack
  • Smoked in our walk in smokehouse
  • High in protein and low in carbs & fat
  • Virtually zero sugar and no unnecessary nasties
  • 100% Grass fed free range British beef
  • Bathed in Cypriot red wine

Related Products