courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Wholewheat Freekeh

Wholewheat Freekeh

£2.09Price

 

Whole grains…

Wholegrain Freekeh are young grains of wheat that are harvested at their nutritional peak and lightly toasted. Unlike our Greenwheat Freekeh, the grains are not cracked and remain whole. With a nutty taste, wholesome texture and hint of smokiness, Wholegrain Freekeh makes a flavourful alternative to rice, couscous and bulgur wheat.

Check out the nutritional benefits:

  • Low GI/low insulin response (good for diabetics)
  • High in Fibre (up to 4 times more than Brown rice!)
  • High in Protein (Approx. 60% higher than rice)
  • Higher in Magnesium, Potassium, Calcium & iron compared to rice and pasta
  • All natural, free from any chemicals
  • Rich in Prebiotic properties
  • GMO free

How to cook Freekeh

  • Pour 100g Wholegrain Freekeh and 600ml of water into a saucepan. 
  • Add 1 tsp salt and 1 tbsp olive oil (optional)
  • Stir, then bring to the boil. 
  • Reduce heat and simmer for 20-30 minutes
  • Drain excess water and use hot, or allow to cool and use warm or cold
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest