top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Sun Dried Tomato Nut Roast

Sun Dried Tomato Nut Roast

£3.39Price
Finally – tasty Nut Roasts that are easy to make!Just add water & bake in the recyclable tray provided.Artisan Grains Nut Roasts are packed with nuts, vegetables and herbs and make an amazing meat-free, vegetarian & vegan loaf which can be enjoyed by all.A healthier protein alternative, try one for lunch, dinner or even as a savoury snack!* Delicious & Nutritious* Quick & easy to prepare* Handy as a store cupboard staple* Convenient – comes in a recyclable baking tray* Home-baked – get involved & cook it how you like itHow to cook our Nut Roasts1. Preheat the oven to 180°C/350°F (Gas mark 4)2. Pour contents of sachet into a bowl3. Add 200ml cold water4. Mix and let sit for 5 mins5. Transfer mix into the baking tray provided6. Bake for 35-40 mins until golden brown, longer for a crunchier bake7. Allow to cool a little8. Slice and serve as desired

Related Products