top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Strawberry Jam 340g

Strawberry Jam 340g

£3.29Price

We use a blend of two varieties of strawberry to maximise flavour, colour and texture.

Prepared with 50g of Fruit per 100g. Total Sugar Content 60g per 100g.

Ingredients: Sugar, Strawberries, Gelling Agent: Citrus Pectin, Concentrated Lemon Juice.

NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1010 kJ/238 kcal, Fat 0g of which saturates 0g, Carbohydrate 58g of which sugars 58g, Protein 0g, Salt 0.02g

bottom of page