top of page
  • Pinterest
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Gourmico Smoked Salmon Pate

Gourmico Smoked Salmon Pate

£3.49Price

Gourmico Smoked Salmon Pate, Enjoy the rich, smoky aroma and silky texture of premium salmon, beautifully complemented by zesty lemon and fragrant dill. Perfect on baguettes or crackers, let our Smoked Salmon Pate add a gourmet touch to your table.

Ingredients
Salmon (61.8%) (Fish), Sunflower Oil, Cod (12%) (Cod (Fish), Salt), Water, Mustard, Lemon Dressing 100%, Pea Protein, Salt, Tapioca Dextrin, Dried Yeast, Tapioca Starch, Onion, Aged Vinegar 6º, Dill, Sweet  and Sour Paprika (Capsicum, Sunflower Oil), White Pepper, Smoke Flavouring (0.11%).

Allergy Advice
For allergens please see ingredients in bold.

  • GLUTEN FREE

Related Products