top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Katsu Curry Cooking Sauce in a Can 330g

Katsu Curry Cooking Sauce in a Can 330g

£4.00Price

An Authentic Japanese Sauce with Coconut Cream, Tamari and Yuzu Juice. Potts' Katsu Curry is a creamy Japanese Curry Sauce with a tang from the citrus Yuzu juice. Comes in a 100% recyclable "beer" can with a fully removable lid.

Make it traditional by heating the sauce in a pan on the hob on medium heat until piping hot. Separately fry or bake 2 breaded chicken breasts and when cooked, serve with the Katsu Curry Sauce and steamed rice. Alternatively, cook 400g of diced chicken in a frying pan with the sauce until cooked through.

Make it vegan by adding 300-400g of diced soya protein pieces and the sauce to the pan. Heat over medium heat until simmering and the pieces are piping hot. Serve with Basmati or Pilau rice.

INGREDIENTS: Water, Coconut Cream (15%), Tamari Soy Sauce (Soya) (9%), Apple, Cornflour, Curry Powder (Coriander, Turmeric, Fenugreek, Chilli, Salt, Fennel, Cumin, Mustard, Black Pepper), Garlic, Ginger, Date Syrup, Sunflower Oil, Yuzu Juice (0.6%), Concentrated Lemon Juice, Turmeric

Get to know
The Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Recipes

Contact

Visit Our Shop

8 West Street,

Wilton Town Centre,

Wiltshire

SP2 0DF

©2025 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

bottom of page