top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Ginger Jam 340g

Ginger Jam 340g

£3.79Price

Our ginger jam is often used as an ingredient in cooking. Otherwise, it is excellent as a rather alternative starter to the day.

Prepared with 58g of Fruit per 100g. Total Sugar Content 62g per 100g.

Ingredients: Sugar, Stem Ginger, Concentrated Lemon Juice, Gelling Agent: Citrus Pectin.

NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1045 kJ/248 kcal, Fat 0g of which saturates 0g, Carbohydrate 61g of which sugars 60g, Protein 0g, Salt 0.02g

bottom of page