top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Ginger Curd

Ginger Curd

£3.90Price

This is a more subtle flavour compared to the other more fruity products in our curd range. Ginger Curd carries more of a spiced flavour and leaves a nice winter warming flavour on your taste buds. It works particularly well when used as a filling for a cheesecake if you want something a little different to a fruity, vibrant cheesecake.
Sugar, Pasteurised Free Range Egg, Pasteurised Free Range Egg Yolk,
Ginger (10%), Butter (Milk, Salt), Concentrated Lemon Juice, Ginger
Ground (0.2%), Gelling Agent: Citrus Pectin, Acidity Regulator: Citric
Acid
For allergens, see ingredients in bold
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1520 kJ/361 kcal, Fat 13g of which saturates 6.5g, Carbohydrate 57g of which sugars 56g, Protein 3.6g, Salt 0.3g.
bottom of page