courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Ginger Curd

Ginger Curd

£3.09Price

This is a more subtle flavour compared to the other more fruity products in our curd range. Ginger Curd carries more of a spiced flavour and leaves a nice winter warming flavour on your taste buds. It works particularly well when used as a filling for a cheesecake if you want something a little different to a fruity, vibrant cheesecake.
Sugar, Pasteurised Free Range Egg, Pasteurised Free Range Egg Yolk,
Ginger (10%), Butter (Milk, Salt), Concentrated Lemon Juice, Ginger
Ground (0.2%), Gelling Agent: Citrus Pectin, Acidity Regulator: Citric
Acid
For allergens, see ingredients in bold
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1520 kJ/361 kcal, Fat 13g of which saturates 6.5g, Carbohydrate 57g of which sugars 56g, Protein 3.6g, Salt 0.3g.
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest