top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Deluxe Mixed Nuts 350g

Deluxe Mixed Nuts 350g

£5.49Price

Deluxe Mixed Nuts 350g,  contain a delicious mix of nuts and NO PEANUTS! Great as a snack, or for use in home baking, these nuts are natural and unroasted, packed full of protein and are also a source of fibre.

Related Products

bottom of page