courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Deluxe Mixed Nuts 100g

Deluxe Mixed Nuts 100g

£1.99Price
We pride ourselves on only using the best ingredients, and our Deluxe Mixed Nuts are no exception. They contain a delicious mix of nuts and NO PEANUTS! Great as a snack, or for use in home baking, these nuts are natural and unroasted, packed full of protein and are also a source of fibre.Ingredients:Brazil Nuts, Almonds, Walnuts, Hazel Nuts, Cashew Nuts
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest