courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Couscous Wild Mushroom

Couscous Wild Mushroom

£1.59Price
Golden Couscous grains
Deliciously seasoned golden couscous grains with rich, nutty Wild Mushrooms & fragrant Herbs. This Couscous is full of aromatic & earthy flavours & makes a delicious alternative to rice, pasta & potatoes.

Check out the nutritional benefits:
Low in fat (contains no saturated fat) – good for weight loss diets
Quick and easy – a convenient ingredient
All natural, no preservatives or chemicals
Rich in Carbohydrates – an essential source of energy
Vegetarian & Vegan
A source of protein
How to prepare Wild Mushroom Couscous (2 portions)
Add ½ pack, 100g of Wild Mushroom Couscous to a heat-proof bowl. 
Pour 150ml of boiling water over the Couscous
Cover and leave to stand for 5 minutes
Add olive oil or butter to taste (optional) and fluff with a fork to separate the grains before serving
Great hot or cold
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest