courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Country vegetable & Cashew nut roast

Country vegetable & Cashew nut roast

£2.79Price

Finally – tasty Nut Roasts that are easy to make!
Just add water & bake in the recyclable tray provided.
Artisan Grains Nut Roasts are packed with nuts, vegetables and herbs and make an amazing meat-free, vegetarian & vegan loaf which can be enjoyed by all.
A healthier protein alternative, try one for lunch, dinner or even as a savoury snack!
* Delicious & Nutritious
* Quick & easy to prepare
* Handy as a store cupboard staple
* Convenient – comes in a recyclable baking tray
* Home-baked – get involved & cook it how you like it

How to cook our Nut Roasts
1. Preheat the oven to 180°C/350°F (Gas mark 4)
2. Pour contents of sachet into a bowl
3. Add 200ml cold water
4. Mix and let sit for 5 mins
5. Transfer mix into the baking tray provided
6. Bake for 35-40 mins until golden brown, longer for a crunchier bake
7. Allow to cool a little
8. Slice and serve as desired
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest