courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Coffee Curd 310g

Coffee Curd 310g

£3.09Price

This flavoursome curd has a smooth velvety texture with a luxury coffee aroma, ideal for baking and great in the middle of muffins.
Ingredients: Sugar, Pasteurised Fresh Free Range EGG, Pasteurised Fresh Free Range EGG Yolk, Butter (MILK, Salt), Coffee Powder (0.5%), Flavouring: Natural Coffee Flavour, Gelling Agent: Citrus Pectin, Acidity Regulator: Citric Acid.
Allergy Advice: For allergens, see ingredients in CAPITALS.
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g, Energy 1473 kJ/354 kcal, Fat 14g of which saturates 7g, Carbohydrate 53g of which sugars 53g, Protein 3.9g, Salt 0.26g.
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest