top of page
courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Cherry Curd 310g

Cherry Curd 310g

£3.90Price
This vibrant curd is bursting with tart cherry flavour. Takes you back to fond memories of childhood sweets.                                         Awarded 2 stars, in the Great Taste Awards 2019.Ingredients: Sugar, Pasteurised Free Range EGG, Pasteurised Free Range EGG Yolk, Butter (MILK, Salt), Concentrated Sour Cherry Juice (10%), Natural Flavour, Gelling Agent: Citrus Pectin, Acidity Regulator: Citric Acid.Allergy Advice: For allergens, see ingredients in CAPS.NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1558 kJ/371 kcal, Fat 14g of which saturates 6.8g, Carbohydrate 57g of which sugars 56g, Protein 3.8g, Salt 0.25g.
bottom of page