courtyardmarketplace-hawsheadrelishpromo

Your Chosen Product

Cherry Curd 310g

Cherry Curd 310g

£3.09Price

This vibrant curd is bursting with tart cherry flavour. Takes you back to fond memories of childhood sweets.                                         Awarded 2 stars, in the Great Taste Awards 2019.
Ingredients: Sugar, Pasteurised Free Range EGG, Pasteurised Free Range EGG Yolk, Butter (MILK, Salt), Concentrated Sour Cherry Juice (10%), Natural Flavour, Gelling Agent: Citrus Pectin, Acidity Regulator: Citric Acid.
Allergy Advice: For allergens, see ingredients in CAPS.
NUTRITIONAL INFORMATION TYPICAL VALUES per 100g. Energy 1558 kJ/371 kcal, Fat 14g of which saturates 6.8g, Carbohydrate 57g of which sugars 56g, Protein 3.8g, Salt 0.25g.
Get to know The
Courtyard Marketplace

HELP

FOLLOW US

Shop

Our Suppliers

About

Blog

Contact

Visit Our Shop

Unit 8, Studio 2,

The Guild Wiltshire,

Wilton SP2 0RS

Call Us: 07568 365447

©2021 by The Courtyard Marketplace. Privacy Policy. Terms & Conditions. Built by An.X Ltd.

0
  • Twitter
  • Pinterest